Protein coding transcript 260110

• Transcript: Ll_transcript_146227
• CDS coordinates: 205-801 (+)
• Peptide sequence: MGELGLAFVKLTKFETEEALFEAQRIRATYTRNVATAAVKASRLYRELNTQTIKHLDKLHDYLGTMLAVNNAFADRSSALLTVQTLSSELVSLNSRIEKLEVASSKVFGGDKSRMRKIEELKEAHRVTENAKTCADREYERIKENNRSELERIDKERHDDFFSMLRGFVVNQAGYAEKMAAVWEKLAEETTTYSIDSS*
• ORF Type: complete

Annotations of Ll_transcript_146227

• Blastp: Sorting nexin 2A from Arabidopsis with 72.54% of identity
• Blastx: Sorting nexin 2A from Arabidopsis with 72.12% of identity
• Eggnog: sorting nexin(COG5391)
• Kegg: Link to kegg annotations (AT5G58440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456646.1)
• Pfam: Vps5 C terminal like (PF09325.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;