Protein coding transcript 260111

• Transcript: Ll_transcript_146235
• CDS coordinates: 126-521 (+)
• Peptide sequence: MTVVELRIFKELKQSVANDWSGTKPLVMEEDKEFMERKEKLLEFEQRLSTVSQQASADFGFCASGNNKKLNIYHLKSDDESKELEHTGHGSGLENVKGMGAEQLLQYGVVAQCLIHSRSVTWCTVPLAAGT*
• ORF Type: complete

Annotations of Ll_transcript_146235

• Blastp: Sorting nexin 2B from Arabidopsis with 61.54% of identity
• Blastx: Sorting nexin 2B from Arabidopsis with 64% of identity
• Eggnog: sorting nexin(COG5391)
• Kegg: Link to kegg annotations (AT5G07120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456646.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;