Protein coding transcript 260162

• Transcript: Ll_transcript_254466
• CDS coordinates: 487-1401 (+)
• Peptide sequence: MDTLHIPLPSRSSQSSAIQAVEKNKFDAAQFSPVWNEIIRNLREEDYITNFELELLLMPRNSGDLPLVQWPLFLLASKIFLAKDIAAESRDNQDELWDRISKDEYMKYAVQECFYAIKHILTEILDEVGRMWVERIYDDINACVTQKTIHLDFQLNKLHIVISRVIALMGILKEAETPELERGAIRAVQDLYDVVRYDVFSVNMRENYDTWNLLTKARDEGHLFSKLKWPKNTDLKAQVKRLHSLLTIKESASSIPKNLEARRRLEFFANSLFMKMPVTKPIREMLSFSVFTPYYSEIVLYSMAE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_254466

• Blastp: Callose synthase 9 from Arabidopsis with 64.59% of identity
• Blastx: Callose synthase 9 from Arabidopsis with 65.34% of identity
• Eggnog: synthase(ENOG410XQ8V)
• Kegg: Link to kegg annotations (AT3G07160)
• CantataDB: Link to cantataDB annotations (CNT0002089)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428289.1)
• Pfam: 1,3-beta-glucan synthase component (PF02364.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;