Transcript | Ll_transcript_254480 |
---|---|
CDS coordinates | 606-1349 (+) |
Peptide sequence | MPRNSGDLPLVQWPLFLLASKIFLAKDIAAESRDNQDELWDRISKDEYMKYAVQECFYAIKHILTEILDEVGRMWVERIYDDINACVTQKTIHLDFQLNKLHIVISRVIALMGILKEAETPELERGAIRAVQDLYDVVRYDVFSVNMRENYDTWNLLTKARDEGHLFSKLKWPKNTDLKAQVKRLHSLLTIKESASSIPKNLEARRRLEFFANSLFMKMPVTKPIREMLSFSVFTPYYSEIVLYSMAE |
ORF Type | 3prime_partial |
Blastp | Callose synthase 9 from Arabidopsis with 65.73% of identity |
---|---|
Blastx | Callose synthase 9 from Arabidopsis with 66.14% of identity |
Eggnog | synthase(ENOG410XQ8V) |
Kegg | Link to kegg annotations (AT3G07160) |
CantataDB | Link to cantataDB annotations (CNT0002089) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428289.1) |
Pfam | 1,3-beta-glucan synthase component (PF02364.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer