Protein coding transcript 260195

• Transcript: Ll_transcript_254636
• CDS coordinates: 1162-1584 (+)
• Peptide sequence: MAALKQPTIRVVAIIAEGVPESDTKELIAYARSNSKGGMSNELYNTIACVTDGIYEGIAIGGDVFPGSTLSDHVLRFNSIPQVKMIVVLGELGGRDEYSLVEALKQGKVAKPVVAWVSGTCARLFKSEVQFGHAELRVVVS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_254636

• Blastp: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 67.61% of identity
• Blastx: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 67.61% of identity
• Eggnog: Succinyl-CoA ligase ADP-forming subunit alpha(COG0074)
• Kegg: Link to kegg annotations (AT3G06650)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017435268.1)
• Pfam: CoA-ligase (PF00549.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;