Transcript | Ll_transcript_254639 |
---|---|
CDS coordinates | 1-318 (+) |
Peptide sequence | DRALTPYEFVESMKKKGIRVPGIGHRIKNRDNKDKRVELLQKFARAHFPSVKYMEYAVEVETYTLTKANNVVLNVDGAIGSLFLDLLAGSGMFSKQEIDEIVEIGY |
ORF Type | internal |
Blastp | ATP-citrate synthase beta chain protein 2 from Arabidopsis with 89.62% of identity |
---|---|
Blastx | ATP-citrate synthase beta chain protein 2 from Arabidopsis with 89.62% of identity |
Eggnog | Succinyl-CoA ligase ADP-forming subunit alpha(COG0074) |
Kegg | Link to kegg annotations (AT5G49460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014491600.1) |
Pfam | Citrate synthase, C-terminal domain (PF00285.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer