Protein coding transcript 260208

• Transcript: Ll_transcript_254651
• CDS coordinates: 213-935 (+)
• Peptide sequence: MATGQLFSRTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINPGSEGFQKLFFGQEEIAIPVHATIEAACAAHPTADVFINFASFRSAAASSLTALKQPTIRVVAIIAEGVPESDTKQLIAYARSNNKVVIGPATVGGIQAGAFKIGDTAGTIDNIIQCKLYRPGSVGFVSKSGGMSNELYNTIARVTDGIYEGIAIGGDVFPGSTLSDHVLRFNNIPQVIFCFRLGELHNVSATHN*
• ORF Type: complete

Annotations of Ll_transcript_254651

• Blastp: ATP-citrate synthase beta chain protein 1 from Oryza sativa with 92.67% of identity
• Blastx: ATP-citrate synthase beta chain protein 1 from Oryza sativa with 92.67% of identity
• Eggnog: Succinyl-CoA ligase ADP-forming subunit alpha(COG0074)
• Kegg: Link to kegg annotations (4325777)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425314.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;