Protein coding transcript 260215

• Transcript: Ll_transcript_254660
• CDS coordinates: 1-555 (+)
• Peptide sequence: VCFFLMATGQLFSRTTQALFYNYKQLPIQRMLDFDFLCGRETPSVAGIINPGSEGFQKLFFGQEEIAIPVHATIEAASAAHPTADVFINFASFRSAAASSLAALKQPTIRVVAIIAEGVPESDTKELIAYARSNNKVVIGPATVGGIQAGAFKIGDTAGTIDNIIQCKLYRPGSVGFVSKSVCC*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_254660

• Blastp: ATP-citrate synthase beta chain protein 1 from Oryza sativa with 93.18% of identity
• Blastx: ATP-citrate synthase beta chain protein 1 from Arabidopsis with 77.19% of identity
• Eggnog: Succinyl-CoA ligase ADP-forming subunit alpha(COG0074)
• Kegg: Link to kegg annotations (4325777)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425314.1)
• Pfam: CoA binding domain (PF02629.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;