Protein coding transcript 260328

• Transcript: Ll_transcript_256302
• CDS coordinates: 2-322 (+)
• Peptide sequence: PTLGKCSRMLSRVCSPLEIKQIMRAEKECAANQLRPEQLIVNGRELRQEELGEILGCPIPPQKLKPGRYWYDKDSGLWGKVIEKLCLWGTIFGVLCFFLYYMINLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_256302

• Blastp: Extra-large guanine nucleotide-binding protein 3 from Arabidopsis with 74.39% of identity
• Blastx: Extra-large guanine nucleotide-binding protein 3 from Arabidopsis with 71.32% of identity
• Eggnog: Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ)
• Kegg: Link to kegg annotations (AT1G31930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003619890.2)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;