Transcript | Ll_transcript_256290 |
---|---|
CDS coordinates | 1766-2944 (+) |
Peptide sequence | MYGNTFTVEELQDVKLMIQSNVYKYLSILLDGRERFEEEAVSRMHGQSSPGQSTEAGSDVETSNNGECIYSLNPRLKHFSDWLLDIIATGDLDAFFPAATREYAPLVEEVWKDPAIQETFKRKDELHFLPDVAEYFLSRAVEISSNEYEPSERDIVYAEGVTQGNGLAFMEFSLDDRCPKFEFTDNLDAQPPQIKYQLIRVNAKGMNEGCKWVEMFEDVRAVIFCVSLSDFDQLWLAPDSSGSGTLLQNKMIQSKELFETMIKHPCFKDTPFVLILNKYDTFEEKISRVSLNACEWFHDFCPMRAHHNNQSLAHQAYFYVAMKFKELYASITGRKLFVSQAKARDRVTVDEAFKYIKEVLKWDEEKEENYYGPPEDSFYSTDISSSPYVRQE* |
ORF Type | complete |
Blastp | Extra-large guanine nucleotide-binding protein 3 from Arabidopsis with 74.31% of identity |
---|---|
Blastx | Extra-large guanine nucleotide-binding protein 3 from Arabidopsis with 75.74% of identity |
Eggnog | Guanine nucleotide binding protein (G protein) alpha(ENOG410XNVQ) |
Kegg | Link to kegg annotations (AT1G31930) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421491.1) |
Pfam | G-protein alpha subunit (PF00503.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer