Transcript | Ll_transcript_524637 |
---|---|
CDS coordinates | 3-386 (+) |
Peptide sequence | VDVPEPGPNELLLKLNCTGLCMSDIHFMMNDWAVPPMSTFGTKCAGHEGAGVVVKVGSAVQGWSVGDRGGVKPLWDVCHNCEHCYSGRENYCQKGVYTGLVATGTYQQYITSPALYTSRIPEGVSDEV |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | Alcohol dehydrogenase 2 from Candida with 44.72% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAALFM_C108330CA) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001242314.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer