Protein coding transcript 260430

• Transcript: Ll_transcript_254745
• CDS coordinates: 1-708 (+)
• Peptide sequence: RWLNYLKPDVKRGNLTLEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRIHKQSRHLKINAYSIEFQELVRHFWIPKLLQKAKESSSSMLIQNQSITMPLGSGPQYSAIATQIPCQGPCINEATGPNYLDQHDQNTDSEHNNGSCISFSESANISEVPNLLGYTTNQFYGLGTNDFGTLTYDGYGVNNDAYEMDAFNMATTIGDCHMVESNWVNNDFACRTWSMDELF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_254745

• Blastp: Transcription factor MYB62 from Arabidopsis with 69.47% of identity
• Blastx: Transcription factor MYB62 from Arabidopsis with 69.47% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT1G68320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432289.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;