Protein coding transcript 260475

• Transcript: Ll_transcript_255260
• CDS coordinates: 79-444 (+)
• Peptide sequence: MASHIVGYPRMGPKRELKFALESFWDKKSSAEDLQKVACDLRASIWKQMADVGIKYIPCNTFSYYDQVLDATAMLGAVPPRYGWSGGEIGFDTYFSMARGNASLPAMEMTKWFDTNYHFIVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_255260

• Blastp: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Catharanthus with 90.16% of identity
• Blastx: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase from Catharanthus with 90.16% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAA58474)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442871.1)
• Pfam: Cobalamin-independent synthase, N-terminal domain (PF08267.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;