Protein coding transcript 260516

• Transcript: Ll_transcript_255372
• CDS coordinates: 1-357 (-)
• Peptide sequence: MVIVFAVKKWHHYLLGRHFKVHSDKKSLRYLTEQNIISEGQQKWMAKLLGYDFEIKYKPGIENKAADALSRKMQFAAISSIQCITWEDIEEEVLQDPKLKKIMQDLMRDPNTHVGFHLI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_255372

• Blastp: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 46.48% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 43.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020220971.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;