Protein coding transcript 260518

• Transcript: Ll_transcript_255379
• CDS coordinates: 572-1042 (-)
• Peptide sequence: MREEDIPKTAFRTHEGHYEYLVMPFGLTNAPSTFQALMNQVLRPYLRKFLLVFFDDILVYSENEELHRFNLKEVLKLLKENKLYANRKKCAFGQTSIEYLGHVITGNGVAANPTKIKAMVDWPPWSYRILPKVCKKLWEDCGTTHSAFKERCFCLE*
• ORF Type: complete

Annotations of Ll_transcript_255379

• Blastp: Retrovirus-related Pol polyprotein from transposon opus from Sophophora with 41.67% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 48.89% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015964281.2)
• Pfam: Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;