| Transcript | Ll_transcript_255851 |
|---|---|
| CDS coordinates | 547-843 (+) |
| Peptide sequence | MSNSFGQNSRGRLKSPWSHRKRKHLLSCHKWKSLFTQDGKLHDGGIKFLKRVRSGGVDPSIRAEVWPFLLGVYNLDSTKAERDVIKTQNRKEYEKLRRQ |
| ORF Type | 3prime_partial |
| Blastp | GTPase-activating protein gyp7 from Schizosaccharomyces with 45.57% of identity |
|---|---|
| Blastx | GTPase-activating protein gyp7 from Schizosaccharomyces with 45.57% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPAC630.05) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417097.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer