Protein coding transcript 260542

• Transcript: Ll_transcript_255853
• CDS coordinates: 401-808 (+)
• Peptide sequence: MSNSFGQNSRGRLKSPWSRRKRKRVLSCPQWKSLFTEDGRLCDGGIKFLKRVRSGGVDPSIRAEVWPFLLGVYDLDSTKAERDVIKTQNRKEYEKLRRQCRQLLKQSNGSFNLNESGEISYEGDDPSLIQDPGSPK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_255853

• Blastp: GTPase-activating protein gyp7 from Schizosaccharomyces with 43.96% of identity
• Blastx: GTPase-activating protein gyp7 from Schizosaccharomyces with 43.96% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC630.05)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415267.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;