Transcript | Ll_transcript_255866 |
---|---|
CDS coordinates | 543-1091 (+) |
Peptide sequence | MNHLSLRRGHNSSSNSSPSSSSWVHLRSVLFVVTSSSPASCSSSSSSSDRGRLKSPWARRRRKRVLSCHRWKSLFTQDGRFHDGGIKFLKRVRSGGVDPSIRAEVWPFLLGVYNLDSTKAERNAIKNQNRKEYEKLRRQCRQLLKQSNGSFKLNESGEISYEGDGASLGQDSGSPNSEDATSA |
ORF Type | 3prime_partial |
Blastp | GTPase-activating protein gyp7 from Schizosaccharomyces with 36.27% of identity |
---|---|
Blastx | GTPase-activating protein gyp7 from Schizosaccharomyces with 40.74% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC630.05) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417096.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer