Protein coding transcript 260557

• Transcript: Ll_transcript_255868
• CDS coordinates: 4191-4754 (+)
• Peptide sequence: MSDLLSPIVSVIPEDHEAFWCFVGFMKKARQNFRLDEVGIRRQLDIVAKIIKFKDGHLFKHLEMLQADDCFFVYRMVVVLFRRELTFEQTLCLWEVMWADQAAIRAGIGKSAWSRIRLRAPPTEDLLLYAIAASVLQRRKLIIEKYSSMDEIIKECNGMAGHLDVWKLLDDAHNLVVSLNDKIKLRQ*
• ORF Type: complete

Annotations of Ll_transcript_255868

• Blastp: GTPase-activating protein GYP7 from Yarrowia with 31.95% of identity
• Blastx: GTPase-activating protein gyp7 from Schizosaccharomyces with 32.09% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YALI0F31911g)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417095.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;