Transcript | Ll_transcript_255871 |
---|---|
CDS coordinates | 4301-4876 (+) |
Peptide sequence | MSDLLSPIVSVIPEDHEAFWCFVGFMKKARQNFRLDEVGIRRQLDIVAKIIKFKDAHLFRHLEKLQADDCFFVYRMVVVLFRRELTFEQTLCLWEVMWADQAAIRAGIGKSAWSRIRQRPPPTDDLLLYAVAASVLQRRKLIIEKYSSMDEIIKECNGMAGHLDVWKLLDDAHNLVVTLNDKMKLRSHSND* |
ORF Type | complete |
Blastp | GTPase-activating protein GYP7 from Yarrowia with 31.95% of identity |
---|---|
Blastx | GTPase-activating protein gyp7 from Schizosaccharomyces with 30.8% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YALI0F31911g) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417095.1) |
Pfam | Rab-GTPase-TBC domain (PF00566.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer