Protein coding transcript 260732

• Transcript: Ll_transcript_256140
• CDS coordinates: 3-488 (+)
• Peptide sequence: PLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARG
• ORF Type: internal

Annotations of Ll_transcript_256140

• Blastp: 26S proteasome regulatory subunit 7 from Spinacia with 100% of identity
• Blastx: 26S proteasome regulatory subunit 7 from Spinacia with 100% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014626850.1)
• Pfam: ATPase family associated with various cellular activities (AAA) (PF00004.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;