Transcript | Ll_transcript_256141 |
---|---|
CDS coordinates | 2-688 (+) |
Peptide sequence | VEQPLQVARCTKIINPNSEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDPSVTMMTVEEKPDVTYNDVGGCKEQIEKMREVVELPMLHPEKFVKLGIDPPKGVLCYGPPGTGKTLLARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFQMARSKKACIVFFDEVDAIGGARFDDGVGGDNEVQRTMLEIVNQLDGFDARGNIKV |
ORF Type | internal |
Blastp | 26S proteasome regulatory subunit 7 from Prunus with 100% of identity |
---|---|
Blastx | 26S proteasome regulatory subunit 7 from Prunus with 100% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (18783658) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_014626850.1) |
Pfam | ATPase family associated with various cellular activities (AAA) (PF00004.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer