Protein coding transcript 260740

• Transcript: Ll_transcript_256215
• CDS coordinates: 87-392 (+)
• Peptide sequence: MTEARWLNCKYIPTTEEYINISLVSSGYPLLMTTSYIGMGEIATEKIFKWVTNESKFVKASTTFARLMDDIVSNEVSMCCVYRDKVEDYIFKINAYCFLKW*
• ORF Type: complete

Annotations of Ll_transcript_256215

• Blastp: Probable terpene synthase 2 from Ricinus with 52% of identity
• Blastx: Sesquiterpene synthase from Santalum with 55.21% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8289511)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420576.1)
• Pfam: Terpene synthase family, metal binding domain (PF03936.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;