Transcript | Ll_transcript_256467 |
---|---|
CDS coordinates | 1-858 (+) |
Peptide sequence | RVGTFRRQLEKIILDKHEDTMSKMGAILASGILDAGGRNVTIRLLSKTKHDKITAVVGLAVFSQFWYWYPLIYFISLSFSPTAFIGLNYDLKSPKFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPTAVLSTSAKAKARAKKAEEQKANAEISGSDSTSAAPSAGKGKSSSEKDDDSMQVDSPREKKSEPEPSFEILTNPARVIPAQEKFVKFLQDSRYVPIKLAPSGFVLLKDLRPTEPEVLSISDTPSSATSAGGESAARLQSSASEMAVDDEPQPPQPFEYTS* |
ORF Type | 5prime_partial |
Blastp | 26S proteasome non-ATPase regulatory subunit 1 homolog A from Arabidopsis with 78.28% of identity |
---|---|
Blastx | 26S proteasome non-ATPase regulatory subunit 1 homolog A from Arabidopsis with 77.59% of identity |
Eggnog | 26s proteasome(COG5116) |
Kegg | Link to kegg annotations (AT2G32730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004503322.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer