Protein coding transcript 260794

• Transcript: Ll_transcript_256475
• CDS coordinates: 1-858 (+)
• Peptide sequence: RVGTFRRQLEKIILDKHEDTMSKMGAILASGILDAGGRNVTIRLLSKTKHDKITAVVGLAVFSQFWYWYPLIYFISLSFSPTAFIGLNYDLKSPKFEFLSHAKPSLFEYPKPTTVPTTTSAVKLPTAVLSTSAKAKARAKKAEEQKANAEISGSDSTSAAPSAGKGKSSSEKDDDSMQVDSPREKKSEPEPSFEILTNPARVIPAQEKFVKFLQDSRYVPIKLAPSGFVLLKDLRPTEPEVLSISDTPSSATSAGGESAARLQSSASEMAVDDEPQPPQPFEYTS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_256475

• Blastp: 26S proteasome non-ATPase regulatory subunit 1 homolog A from Arabidopsis with 78.28% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 1 homolog A from Arabidopsis with 77.59% of identity
• Eggnog: 26s proteasome(COG5116)
• Kegg: Link to kegg annotations (AT2G32730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004503322.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;