Transcript | Ll_transcript_254328 |
---|---|
CDS coordinates | 237-665 (+) |
Peptide sequence | MEEALELVRAKDAKERMAGVELLHQLLEASRRTLTSTEVTNLVRCCLDLLNDNSFRVSQGALQALASAAVLSAENFKLHLNTIVPAAVDRLGDAKQPVRDAARRLLLTLMEACLNYGISFVFVFELMETKHAFSVNLVYVGI* |
ORF Type | complete |
Blastp | CLIP-associated protein from Arabidopsis with 76.58% of identity |
---|---|
Blastx | CLIP-associated protein from Arabidopsis with 76.58% of identity |
Eggnog | cytoplasmic linker associated protein(ENOG410ZMY0) |
Kegg | Link to kegg annotations (AT2G20190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429580.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer