| Transcript | Ll_transcript_254333 |
|---|---|
| CDS coordinates | 1-369 (+) |
| Peptide sequence | SGYITGEIKPSSVNPKKSSPKAKHSSREASLFGGDGDVTEKPVDPIKVYSEKELIREVEKIASTLVPQKDWSIRIAAMQRIEGLILGGAADYLSFRGLLKQLIGPLSTQLSDRRSSIVKQVH* |
| ORF Type | 5prime_partial |
| Blastp | CLIP-associated protein from Arabidopsis with 74.58% of identity |
|---|---|
| Blastx | CLIP-associated protein from Arabidopsis with 78.72% of identity |
| Eggnog | cytoplasmic linker associated protein(ENOG410ZMY0) |
| Kegg | Link to kegg annotations (AT2G20190) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444406.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer