| Transcript | Ll_transcript_254324 |
|---|---|
| CDS coordinates | 1-297 (+) |
| Peptide sequence | SGYITGEIKPSSVNPKKSSPKAKHSSREASLFGGDGDVTEKPVDPIKVYSEKELIREVEKIASTLVPQKDWSIRIAAMQRIEGLILGGWCFHTPRQEYA |
| ORF Type | internal |
| Blastp | CLIP-associated protein from Arabidopsis with 68.82% of identity |
|---|---|
| Blastx | CLIP-associated protein from Arabidopsis with 77.42% of identity |
| Eggnog | cytoplasmic linker associated protein(ENOG410ZMY0) |
| Kegg | Link to kegg annotations (AT2G20190) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444406.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer