Transcript | Ll_transcript_255615 |
---|---|
CDS coordinates | 2-730 (+) |
Peptide sequence | FTGDVEAVNPVTKLHFRGARVFAAVIEDLLAKGMKNARNAIISGCSAGGLASIIHCDRFRSFLPEGAKVKCISDAGYFINARDVSGTRHIEQLFSEIVATHGSARNLPPSCTSRLSPGMCFFPQYFVSQIATPIFLINAAYDSWQIKNILAPGVADPHGRWHSCKLDINNCSPNQLGTMQGFRTEFLKALTVLGNSQSKGMFIDSCYAHCQTEMQETWFTTDSPLLAKTVRRKCSNIIYNMS* |
ORF Type | 5prime_partial |
Blastp | Pectin acetylesterase 8 from Arabidopsis with 64.73% of identity |
---|---|
Blastx | Pectin acetylesterase 8 from Arabidopsis with 66.95% of identity |
Eggnog | pectinacetylesterase(ENOG410XQKD) |
Kegg | Link to kegg annotations (AT4G19420) |
CantataDB | Link to cantataDB annotations (CNT0000075) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445193.1) |
Pfam | Pectinacetylesterase (PF03283.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer