Transcript | Ll_transcript_254920 |
---|---|
CDS coordinates | 384-1025 (+) |
Peptide sequence | MIDPADQKWLKVAEILIADASNLEEKATNSKCYCFRSCPNLIGRYCLAKQIEKKTKAMLDHKNKEGNKFRQFDHLLPLPGMEYYCKEGVIYFNSIKAAYDQIIDALKDDEVDMVGLYGMGGCGKTTLAHVVAKEAEHLFDKVLFLSVTSTVDVRKIQGKIAGSLGLKLEEEDEAERARRLWLSLTNSEERILITLDGVWEKLDFKAIGIPFGED |
ORF Type | 3prime_partial |
Blastp | Disease resistance protein RFL1 from Arabidopsis with 36.67% of identity |
---|---|
Blastx | Probable disease resistance protein At5g47250 from Arabidopsis with 27.14% of identity |
Eggnog | leucine Rich Repeat(COG4886) |
Kegg | Link to kegg annotations (AT1G12210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433962.1) |
Pfam | NB-ARC domain (PF00931.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer