Protein coding transcript 261008

• Transcript: Ll_transcript_254920
• CDS coordinates: 384-1025 (+)
• Peptide sequence: MIDPADQKWLKVAEILIADASNLEEKATNSKCYCFRSCPNLIGRYCLAKQIEKKTKAMLDHKNKEGNKFRQFDHLLPLPGMEYYCKEGVIYFNSIKAAYDQIIDALKDDEVDMVGLYGMGGCGKTTLAHVVAKEAEHLFDKVLFLSVTSTVDVRKIQGKIAGSLGLKLEEEDEAERARRLWLSLTNSEERILITLDGVWEKLDFKAIGIPFGED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_254920

• Blastp: Disease resistance protein RFL1 from Arabidopsis with 36.67% of identity
• Blastx: Probable disease resistance protein At5g47250 from Arabidopsis with 27.14% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT1G12210)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433962.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;