Protein coding transcript 261032

• Transcript: Ll_transcript_254926
• CDS coordinates: 244-603 (+)
• Peptide sequence: MASSNRHWPSMFKSKPKPCNPHHHQWQHDITSSLISNACHRSPYTSGVGLEERSPEPKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRRSRSRRRQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_254926

• Blastp: WUSCHEL-related homeobox 9 from Arabidopsis with 79.17% of identity
• Blastx: WUSCHEL-related homeobox 9 from Arabidopsis with 81.25% of identity
• Eggnog: homeobox(ENOG410Y94H)
• Kegg: Link to kegg annotations (AT2G33880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418741.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;