Protein coding transcript 261068

• Transcript: Ll_transcript_256700
• CDS coordinates: 1-600 (+)
• Peptide sequence: FILYATYLSEKIGYWRYITIYRHLKTNPEYQCYPIFKFFENWCQDENRHGDFISAMMKAHPTFLNDWKAKLWSRFFCLSVYVTMYLNDCQRTSFYEGIGLDTKEFDMHVIIETNRTAARLFPAVLDVENPKFQQRLDKMVEISEKISAVNESNDIEVVKNLKKIPLIASLVSELLATYLMPPVEAGSVDLAEFEPRLVY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_256700

• Blastp: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 84.92% of identity
• Blastx: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 84.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456731.1)
• Pfam: Rubrerythrin (PF02915.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;