Protein coding transcript 261072

• Transcript: Ll_transcript_256689
• CDS coordinates: 511-828 (+)
• Peptide sequence: MYLNDCQRTDFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRRLDRMVEINEKILAIGESDDIPVVKNLKRIPLIAALVSELLATYLMPPIESGSVD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_256689

• Blastp: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 90.57% of identity
• Blastx: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 89.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429443.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;