Protein coding transcript 261073

• Transcript: Ll_transcript_256690
• CDS coordinates: 3-716 (+)
• Peptide sequence: PIVAQIFSLMSRDEARHAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLKTNPEYQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNDWKAKLWARFFCLSVYVTMYLNDCQRTDFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRRLDRMVEINEKILAIGESDDIPVVKNLKRIPLIAALVSELLATYLMPPIESGSVD
• ORF Type: internal

Annotations of Ll_transcript_256690

• Blastp: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 93.7% of identity
• Blastx: Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic from Gossypium with 93.7% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458029.1)
• Pfam: Rubrerythrin (PF02915.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;