Protein coding transcript 261103

• Transcript: Ll_transcript_254853
• CDS coordinates: 203-634 (+)
• Peptide sequence: MTQEESKQQASYVHLQGLKGKVINQVKNLSVEAGGKGSAKKDLSSQRSLFRDIVEFFEYGYPPEISMKIGGDSLQTSSWSQMIQLNYLKHFLGGGFIKHMQDNEFLHDVFDFTPKRKHLNNNEQRMSSGEKRMFKSSNSFQNKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_254853

• Blastp: Interferon-related developmental regulator 1 from Mus with 37.04% of identity
• Blastx: Interferon-related developmental regulator 1 from Homo with 33.33% of identity
• Eggnog: Interferon-related developmental regulator(ENOG410XSIZ)
• Kegg: Link to kegg annotations (15982)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436959.1)
• Pfam: Interferon-related developmental regulator (IFRD) (PF05004.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;