Transcript | Ll_transcript_254853 |
---|---|
CDS coordinates | 203-634 (+) |
Peptide sequence | MTQEESKQQASYVHLQGLKGKVINQVKNLSVEAGGKGSAKKDLSSQRSLFRDIVEFFEYGYPPEISMKIGGDSLQTSSWSQMIQLNYLKHFLGGGFIKHMQDNEFLHDVFDFTPKRKHLNNNEQRMSSGEKRMFKSSNSFQNKA |
ORF Type | 3prime_partial |
Blastp | Interferon-related developmental regulator 1 from Mus with 37.04% of identity |
---|---|
Blastx | Interferon-related developmental regulator 1 from Homo with 33.33% of identity |
Eggnog | Interferon-related developmental regulator(ENOG410XSIZ) |
Kegg | Link to kegg annotations (15982) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436959.1) |
Pfam | Interferon-related developmental regulator (IFRD) (PF05004.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer