Transcript | Ll_transcript_256335 |
---|---|
CDS coordinates | 2719-3912 (-) |
Peptide sequence | MVEALGLAKLVESKIKDAKPALPRPFRTNNFPAPNQRAHSVSSVGNSNTVSIMPIRRLTTAQMQERRAQGLCYNCDEKYLTGHICQGRQFVLLLVYDLSATSEDLLISLEPVKVEHVQPIEDLIHFQLSKQALEGQPSQKTLRLTGSIVGQAVMVLVDTGSSHNVLQPRLAHHLQLNITPTPKFPVMVGNGAHIYCTGLCSDTLIVLQNKLFHIPFYLLPIKGANVVLRIEWLRTLGPIISDFVVLSMTFKVGNDSLTLQGDTTTPITQSSLHQLTRLLHTDSVASFHTLIFIPLQPTTTLHTDQPKTTHPPIQTVLTKYNDIFQRPHGLPPSRPHDHSITLQPNSSPISLKPYRYPHSQKEAMTTMIADMLKDGIITPSTSPFSSPVLLVKKKDGT* |
ORF Type | complete |
Blastp | Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 29.17% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 38.68% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YIL082W-A) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459949.1) |
Pfam | Retroviral aspartyl protease (PF08284.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer