Transcript | Ll_transcript_256341 |
---|---|
CDS coordinates | 2842-3981 (-) |
Peptide sequence | PNQRAHSVSSVGNSNTVSIMPIRRLTTAQMQERRAQGLCYNCDEKYLTGHICQGRQFVLLLVYDLSATSEDLLISLEPVKVEHVQPIEDLIHFQLSKQALEGQPSQKTLRLTGSIVGQAVMVLVDTGSSHNVLQPRLAHHLQLNITPTPKFPVMVGNGAHIYCTGLCSDTLIVLQNKLFHIPFYLLPIKGANVVLRIEWLRTLGPIISDFVVLSMTFKVGNDSLTLQGDTTTPITQSSLHQLTRLLHTDSVASFHTLIFIPLQPTTTLHTDQPKTTHPPIQTVLTKYNDIFQRPHGLPPSRPHDHSITLQPNSSPISLKPYRYPHSQKEAMTTMIADMLKDGIITPSTSPFSSPVLLVKKRWHIAVLCGLLSSECNHSS* |
ORF Type | 5prime_partial |
Blastp | Retrovirus-related Pol polyprotein from transposon 412 from Sophophora with 24.05% of identity |
---|---|
Blastx | Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 41.83% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450597.1) |
Pfam | Retroviral aspartyl protease (PF08284.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer