Protein coding transcript 261172

• Transcript: Ll_transcript_256127
• CDS coordinates: 219-1601 (+)
• Peptide sequence: MWDHRLIYAANSGNETGLSSSIPDDKERHIDEYQTSMASMEEKGFSGVNSIYDDPSVGVGQGGVDGKISQSDALHQEIDMAENKNNMKEDLPNLSIRKSISNQSELFEPELGVQIALSDGPFPVIPSLSDTLDAKWTGEDYSGLGIQKDNTSVNSDTFMVDASANTVHKEAYSLGDHAEDQNGLKGIHSASKGHDNMEDSLSWLGMPFLNFYRQFNKNFFASTQNIDTIVDYNPVYVSSFRKLELQGGARLLLPIGVNDTVIPVYDDEPSSIIAYALTSPDYHFQLTDDGERPKDGIELASSYFSDSSAFHSFTSADDTAFDSQKSFGSIEDMILSISGSRSSSMLDPVSYTKSMHTRISFGEDGPLGKVKYSVTCYYANRFEALRRVCCPSELDYIRSLSRCKKWRAQGGKSNVFFAKTLDDRFIIKQVTKTELDSFIKFGPEYFKYLSESIGTGSPTCL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_256127

• Blastp: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B from Arabidopsis with 49.79% of identity
• Blastx: 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B from Arabidopsis with 50.7% of identity
• Eggnog: Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions (By similarity)(COG0459)
• Kegg: Link to kegg annotations (AT3G14270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456070.1)
• Pfam: Phosphatidylinositol-4-phosphate 5-Kinase (PF01504.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;