Protein coding transcript 261237

• Transcript: Ll_transcript_256437
• CDS coordinates: 806-1138 (+)
• Peptide sequence: MAVYYKFKSARDYDSIPMDGPFISVGTLKEKIFETKHLGRGTDFDLVVTNAQTNEEYLDEAMLIPKNTSVLVGRVPGRPRLPIVTKIEQKLENKTATFTNSHQNRAKAGK*
• ORF Type: complete

Annotations of Ll_transcript_256437

• Blastp: E3 ubiquitin ligase PARAQUAT TOLERANCE 3 from Arabidopsis with 71.15% of identity
• Blastx: E3 ubiquitin ligase PARAQUAT TOLERANCE 3 from Arabidopsis with 71.15% of identity
• Eggnog: Retinoblastoma binding protein 6(COG5222)
• Kegg: Link to kegg annotations (AT4G17410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432666.1)
• Pfam: DWNN domain (PF08783.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;