Protein coding transcript 261245

• Transcript: Ll_transcript_256444
• CDS coordinates: 251-565 (+)
• Peptide sequence: MFFPIFGDEKTLVSFMILCFSFTLACSQGSDFGGGRSFGRGMGGRMVAGRGFGLEQKTPPQGYVCHRCKLPGHFIQHCPTNGDSNFDIKRVKQPTGIPRSMLMVN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_256444

• Blastp: E3 ubiquitin ligase PQT3-like from Arabidopsis with 63.27% of identity
• Blastx: E3 ubiquitin ligase PQT3-like from Arabidopsis with 78.43% of identity
• Eggnog: Retinoblastoma binding protein 6(COG5222)
• Kegg: Link to kegg annotations (AT5G47430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421620.1)
• Pfam: Zinc knuckle (PF13696.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;