Transcript | Ll_transcript_256444 |
---|---|
CDS coordinates | 251-565 (+) |
Peptide sequence | MFFPIFGDEKTLVSFMILCFSFTLACSQGSDFGGGRSFGRGMGGRMVAGRGFGLEQKTPPQGYVCHRCKLPGHFIQHCPTNGDSNFDIKRVKQPTGIPRSMLMVN |
ORF Type | 3prime_partial |
Blastp | E3 ubiquitin ligase PQT3-like from Arabidopsis with 63.27% of identity |
---|---|
Blastx | E3 ubiquitin ligase PQT3-like from Arabidopsis with 78.43% of identity |
Eggnog | Retinoblastoma binding protein 6(COG5222) |
Kegg | Link to kegg annotations (AT5G47430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421620.1) |
Pfam | Zinc knuckle (PF13696.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer