Transcript | Ll_transcript_256450 |
---|---|
CDS coordinates | 806-1153 (+) |
Peptide sequence | MAVYYKFKSARDYDSIPMDGPFISVGTLKEKIFETKHLGRGTDFDLVVTNAQTNEGKSWKIRRQKLNLITVAYQLPIHLPWDILKIFMRTSLATICIQIRMHSLSNQATLAWRLL* |
ORF Type | complete |
Blastp | E3 ubiquitin ligase PQT3-like from Arabidopsis with 81.82% of identity |
---|---|
Blastx | E3 ubiquitin ligase PQT3-like from Arabidopsis with 81.82% of identity |
Eggnog | Retinoblastoma binding protein 6(COG5222) |
Kegg | Link to kegg annotations (AT5G47430) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432666.1) |
Pfam | DWNN domain (PF08783.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer