Protein coding transcript 261254

• Transcript: Ll_transcript_256426
• CDS coordinates: 806-1336 (+)
• Peptide sequence: MAVYYKFKSARDYDSIPMDGPFISVGTLKEKIFETKHLGRGTDFDLVVTNAQTNEEYLDEAMLIPKNTSVLVGRVPGRPRLPIVTKIEQKLENKTAETEPDNSSLPVTNTSAMGYTEDIYEDEFGNDLYPDPDAQPVQSSHFGLEAPLTNNADEDLDSKIKAVVDTPALDWQRLQE*
• ORF Type: complete

Annotations of Ll_transcript_256426

• Blastp: E3 ubiquitin ligase PQT3-like from Arabidopsis with 61.02% of identity
• Blastx: E3 ubiquitin ligase PQT3-like from Arabidopsis with 58.2% of identity
• Eggnog: Retinoblastoma binding protein 6(COG5222)
• Kegg: Link to kegg annotations (AT5G47430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432666.1)
• Pfam: DWNN domain (PF08783.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;