Protein coding transcript 261256

• Transcript: Ll_transcript_256428
• CDS coordinates: 756-1310 (+)
• Peptide sequence: MAVYYKFKSARDYDSIPMDGPFISVGTLKEKIFETKHLGRGTDFDLVVTNAQTNEEYLDEAMLIPKNTSVLVGRVPGRPRLPIVTKIEQKLENKTAETEPDNSSLPVTNTSAMGYTEDIYEDEFGNDLYPDPDAQPVQSSHFGLEAPLTNNADEDLDSKIKAVVDTPALDWQRQDFGGGRGFGRG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_256428

• Blastp: E3 ubiquitin ligase PQT3-like from Arabidopsis with 60.21% of identity
• Blastx: E3 ubiquitin ligase PQT3-like from Arabidopsis with 60.8% of identity
• Eggnog: Retinoblastoma binding protein 6(COG5222)
• Kegg: Link to kegg annotations (AT5G47430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432666.1)
• Pfam: DWNN domain (PF08783.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;