Transcript | Ll_transcript_254446 |
---|---|
CDS coordinates | 76-834 (-) |
Peptide sequence | VDYCKHIATPMGSGTYIDANEPEKCIDISKYRGMIGSLLYLTASRPDIMFSVCLCARYQSKPKESHLVVVKRIMKYLKGTTEVGLWYPKGSICELVRYSDSDFAGWKSERKSTCGTCHILGNALVSWSCKKQACVTLSTADAEYIAADSCCTQVLWLKQQLRDYGLDLGCTPLKCDNTSVINLTKNPILHSRTKHIDIRHHFLRDHVQKKYVSVEFVDTYNQLADIFTKPLAKEPFYKIRHELGILDEAYLS* |
ORF Type | 5prime_partial |
Blastp | Copia protein from Sophophora with 37.25% of identity |
---|---|
Blastx | Copia protein from Sophophora with 37.25% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0002658) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_016192204.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer