Protein coding transcript 261410

• Transcript: Ll_transcript_254446
• CDS coordinates: 76-834 (-)
• Peptide sequence: VDYCKHIATPMGSGTYIDANEPEKCIDISKYRGMIGSLLYLTASRPDIMFSVCLCARYQSKPKESHLVVVKRIMKYLKGTTEVGLWYPKGSICELVRYSDSDFAGWKSERKSTCGTCHILGNALVSWSCKKQACVTLSTADAEYIAADSCCTQVLWLKQQLRDYGLDLGCTPLKCDNTSVINLTKNPILHSRTKHIDIRHHFLRDHVQKKYVSVEFVDTYNQLADIFTKPLAKEPFYKIRHELGILDEAYLS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_254446

• Blastp: Copia protein from Sophophora with 37.25% of identity
• Blastx: Copia protein from Sophophora with 37.25% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002658)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016192204.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;