Protein coding transcript 261480

• Transcript: Ll_transcript_256798
• CDS coordinates: 1-435 (+)
• Peptide sequence: SLPKESHFITVKRIMRYLKGTSNMRLWYPRDVSLALVGYSDFDFAECKLDRKSISGTCHLLGISLVAWHSKKQACVALSTAEAEYIVADVCCAQILWMNQQLKDFGLEIEKIPIKCDNTSAINLSKNLILHSRTKHIEIRHHFLL
• ORF Type: internal

Annotations of Ll_transcript_256798

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 40.85% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 40.85% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002658)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434279.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;