| Transcript | Ll_transcript_256785 |
|---|---|
| CDS coordinates | 2-418 (+) |
| Peptide sequence | GTCHLLGSSLVAWHSKKKACVALSTAEAEYIAAGVCCTQILWMKQQLKDFGLKIEKIPIKSDNTSAINLSKNLILHSRTKHIEIRHHFLCDHVQKGDYVLKFVETSKQLADIFTKPLPRDTFYVLRRKLGILDEQYLA* |
| ORF Type | 5prime_partial |
| Blastp | Copia protein from Sophophora with 41.35% of identity |
|---|---|
| Blastx | Copia protein from Sophophora with 41.35% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | Link to cantataDB annotations (CNT0002658) |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016192204.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer