Protein coding transcript 261488

• Transcript: Ll_transcript_255923
• CDS coordinates: 1127-1561 (+)
• Peptide sequence: MLLRLRQACDHPLLVKDYNSNPVGQDSVEMAKRLPRDLVTNLYMELDTTSAICHVCNDPPEDPVITMCSHVFCYQCVSDFLTAGDNTCPAVYCKETVGEDVVFSKATLRSCFSDDLGGSSSSNSHHVDYSLFQDSEYNSSKIKAV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_255923

• Blastp: Helicase-like transcription factor CHR28 from Arabidopsis with 60.69% of identity
• Blastx: Helicase-like transcription factor CHR28 from Arabidopsis with 65.05% of identity
• Eggnog: Transcription termination factor, RNA polymerase II(ENOG410XPDU)
• Kegg: Link to kegg annotations (AT1G50410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427505.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;