Protein coding transcript 261490

• Transcript: Ll_transcript_255928
• CDS coordinates: 1127-1870 (+)
• Peptide sequence: MLLRLRQACDHPLLVKDYNSNPVGQDSIEMAKRLPRDFLINLYKELDTTSAICHVCNDPPEDPVITMCSHVFCYQCVSDFLTADNTCPAVYCKETIGEDVVFSKTTLRSCISDDLDGSGSSNSHHVDYSLFQDTEYNSSKIKAVLEILQSNRKMKAPSSGSPNSSGGHGDLPSDDISFIEDCDSDVRVTKRTRKYSEPITEGAIKAIIFSQWTSMLDLLEDALKQSRTRIRYRRLDGRMTLLARDKAV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_255928

• Blastp: Helicase-like transcription factor CHR28 from Arabidopsis with 53.17% of identity
• Blastx: Helicase-like transcription factor CHR28 from Arabidopsis with 58.71% of identity
• Eggnog: Transcription termination factor, RNA polymerase II(ENOG410XPDU)
• Kegg: Link to kegg annotations (AT1G50410)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441655.1)
• Pfam: Zinc finger, C3HC4 type (RING finger) (PF13920.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;