Transcript | Ll_transcript_255913 |
---|---|
CDS coordinates | 2-1360 (+) |
Peptide sequence | ERFGLSSVFSASKKRKKAYNGNKKSKKGRKGIDSSLDCGSGPLAKVGWFRIILDEAQTIKNHRTQVARACCSLRAKRRWCLSGTPIQNTIDDLYSYFRFLRYDPYAVYKSFYNTIKVPISRNSIQGYKKLQAVLRAIMLRRTKGTLIDGQPIINLPPKKIELTKVDFSGEERDFYTKLEADSRSQFKAYAAAGTVNQNYANILLMLLRLRQACDHPLLVKDYNSNPVGQDSVEMAKRLPRDLVTNLYMELDTTSAICHVCNDPPEDPVITMCSHVFCYQCVSDFLTAGDNTCPAVYCKETVGEDVVFSKATLRSCFSDDLGGSSSSNSHHVDYSLFQESEYNSSKIKAVLEILQSNRKMKAPTSGSPNSSGGHGDLLSSDISYIEDCDSDIQVTKYTRKYSEPTTEGPIKAIIFSQWTSMLDLVEDALKQSRTRIRYRRLDGRMTLLARDKAV |
ORF Type | internal |
Blastp | Helicase-like transcription factor CHR28 from Arabidopsis with 65.28% of identity |
---|---|
Blastx | Helicase-like transcription factor CHR28 from Arabidopsis with 64.25% of identity |
Eggnog | Transcription termination factor, RNA polymerase II(ENOG410XPDU) |
Kegg | Link to kegg annotations (AT1G50410) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427505.1) |
Pfam | SNF2 family N-terminal domain (PF00176.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer