Protein coding transcript 261573

• Transcript: Ll_transcript_256844
• CDS coordinates: 3-485 (+)
• Peptide sequence: CELGKFEGSGHFLFLEGSIDLVTVIKRVSFYRRGKYHDYVLDFLPPTINEAKEEIKANSLINTLTSPVMLSTLEDGTIVKGLAGIPSEGPVLFVGYHMMLGLDLAPLLSGIFMERNILVRVLGHPFLFSRKEMGIVPELSIFDGVKLMGVVPVGPTGFFKL
• ORF Type: internal

Annotations of Ll_transcript_256844

• Blastp: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 49.07% of identity
• Blastx: Acyltransferase-like protein At3g26840, chloroplastic from Arabidopsis with 49.07% of identity
• Eggnog: Acyltransferase(COG0204)
• Kegg: Link to kegg annotations (AT3G26840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437421.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;